Recombinant Rat Glia Maturation Factor beta (Rat GMF-β) _92269ES

Yeasen

Catalog ID: 92269ES10
Size: 10 μg
Price:
Sale price$190.00

Shipping calculated at checkout

Stock:
In stock
Bulk Quote Inquiry

Description

The glia maturation factor beta belongs to the actin-binding proteins ADF family, GMF subfamily. It contains an ADF-H domain, but the research of crystallography and NMR reveals that there are structures different between human and mouse ADF-H domain. GMF-β is involved in the differentiation, maintenance, and regeneration of the nervous system. It also inhibition of proliferation of tumor cells.

 

Product Properties

Synonyms

Glia maturation factor beta, GMF-beta

Accession

Q63228

GeneID

81661

Source

E.coli-derived rat Glia Maturation Factor beta protein,Ser2-His142

Molecular Weight

Approximately 16.6 kDa.

AA Sequence

SESLVVCDVAEDLVEKLRKFRFRKETHNAAIIMKIDKDKRLVVLDEELEGVSPDELKDELPERQPRFIVYSYKYQHDDGRVSYPLCFIFSSPLGCKPEQQMMYAGSKNKLVQTAELTKVFEIRNTEDLTEWLREKLGFFH

Tag

None

Physical Appearance

Sterile Filtered White lyophilized (freeze-dried) powder.

Purity

> 98 % by SDS-PAGE and HPLC analyses.

Biological Activity

Data is not available.

Endotoxin

< 1.0 EU per 1μg of the protein by the LAL method.

Formulation

Lyophilized from a 0.2 μm filtered concentrated solution in PBS, pH 7.4.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤ -20°C. Further dilutions should be made in appropriate buffered solutions.

 

Shipping and Storage

The products are shipped with ice pack and can be stored at -20℃ to -80℃ for 1 year.

Recommend to aliquot the protein into smaller quantities when first used and avoid repeated freeze-thaw cycles.

 

Cautions

1. Avoid repeated freeze-thaw cycles.

2. For your safety and health, please wear lab coats and disposable gloves for operation.

3. For research use only!

Yeasen Inquiry

You may also like